Recombinant Human CANX Protein, GST-Tagged

• Cat.No.: CANX-0350H
• Product Overview: Human CANX partial ORF (NP_001737.1, 504 a.a. - 592 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.53 kDa
• AA Sequence: SGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CANX calnexin [ Homo sapiens ]
• Official Symbol: CANX
• Synonyms: CANX; calnexin; CNX; IP90; major histocompatibility complex class I antigen binding protein p88; P90; major histocompatibility complex class I antigen-binding protein p88; FLJ26570
• Gene ID: 821
• mRNA Refseq: NM_001024649
• Protein Refseq: NP_001019820
• MIM: 114217
• UniProt ID: P27824