Recombinant Human CAND1 Protein, GST-Tagged

Cat.No. : CAND1-0347H
Product Overview : Human CAND1 partial ORF (NP_060918, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an essential regulator of Cullin-RING ubiquitin ligases, which are in involved in ubiquitinylation of proteins degraded by the Ub proteasome system. The encoded protein binds to unneddylated cullin-RING box protein complexes and acts as an inhibitor of cullin neddylation and of Skp1, cullin, and F box ubiquitin ligase complex assembly and activity. In mammalian cell culture, this protein predominantly localizes to the cytoplasm. Knockdown of this gene in preadipocytes results in blocked adipogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]
Molecular Mass : 36.74 kDa
AA Sequence : MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CAND1 cullin-associated and neddylation-dissociated 1 [ Homo sapiens ]
Official Symbol CAND1
Synonyms CAND1; cullin-associated and neddylation-dissociated 1; cullin-associated NEDD8-dissociated protein 1; DKFZp434M1414; KIAA0829; TBP interacting protein; TIP120; TIP120A; p120 CAND1; TBP-interacting protein 120A; TBP-interacting protein of 120 kDa A; cullin-associated and neddylation-dissociated protein 1; FLJ10114; FLJ10929; FLJ38691; FLJ90441;
Gene ID 55832
mRNA Refseq NM_018448
Protein Refseq NP_060918
MIM 607727
UniProt ID Q86VP6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CAND1 Products

Required fields are marked with *

My Review for All CAND1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon