Recombinant Human CAMK1D Protein, GST-tagged

Description :	This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Source :	E. coli
Species :	Human
Tag :	GST
Form :	Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass :	69.2kD
AA Sequence :	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMARENGESSSSWKKQAEDIKKIFEFKETL
Endotoxin :	Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity :	>95% as determined by SDS-PAGE and Coomassie blue staining

Gene Name	CAMK1D calcium/calmodulin-dependent protein kinase ID [ Homo sapiens ]
Official Symbol	CAMK1D
Synonyms	CAMK1D; calcium/calmodulin-dependent protein kinase ID; calcium/calmodulin-dependent protein kinase type 1D; CKLiK; caMKI delta; caM-KI delta; CaM kinase ID; caM kinase I delta; CamKI-like protein kinase; CaM-K1; CaMKID;
Gene ID	57118
mRNA Refseq	NM_020397
Protein Refseq	NP_065130
MIM	607957
UniProt ID	Q8IU85