Recombinant Human CALCR

Cat.No. : CALCR-27793TH
Product Overview : Recombinant fragment: CNNEVQTTVK RQWAQFKIQW NQRWGRRPSN RSARAAAAAA EAGDIPIYIC HQELRNEPAN NQGEESAEII PLNIIEQESS A corresponding to amino acids 394-474 of Human Calcitonin receptor with an N terminal proprietary tag; Predicted MWt 34.54 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 81 amino acids
Description : This gene encodes a high affinity receptor for the peptide hormone calcitonin and belongs to a subfamily of seven transmembrane-spanning G protein-coupled receptors. The encoded protein is involved in maintaining calcium homeostasis and in regulating osteoclast-mediated bone resorption. Polymorphisms in this gene have been associated with variations in bone mineral density and onset of osteoporosis. Alternate splicing results in multiple transcript variants.
Molecular Weight : 34.540kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
Sequence Similarities : Belongs to the G-protein coupled receptor 2 family.
Gene Name CALCR calcitonin receptor [ Homo sapiens ]
Official Symbol CALCR
Synonyms CALCR; calcitonin receptor; CTR;
Gene ID 799
mRNA Refseq NM_001164737
Protein Refseq NP_001158209
MIM 114131
Uniprot ID P30988
Chromosome Location 7q21.3
Pathway Calcitonin-like ligand receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function calcitonin binding; NOT calcitonin binding; calcitonin binding; calcitonin receptor activity; calcitonin receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CALCR Products

Required fields are marked with *

My Review for All CALCR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon