Recombinant Human CALCR

• Cat.No.: CALCR-27793TH
• Product Overview: Recombinant fragment: CNNEVQTTVK RQWAQFKIQW NQRWGRRPSN RSARAAAAAA EAGDIPIYIC HQELRNEPAN NQGEESAEII PLNIIEQESS A corresponding to amino acids 394-474 of Human Calcitonin receptor with an N terminal proprietary tag; Predicted MWt 34.54 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 81 amino acids
• Description: This gene encodes a high affinity receptor for the peptide hormone calcitonin and belongs to a subfamily of seven transmembrane-spanning G protein-coupled receptors. The encoded protein is involved in maintaining calcium homeostasis and in regulating osteoclast-mediated bone resorption. Polymorphisms in this gene have been associated with variations in bone mineral density and onset of osteoporosis. Alternate splicing results in multiple transcript variants.
• Molecular Weight: 34.540kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
• Sequence Similarities: Belongs to the G-protein coupled receptor 2 family.

Gene Information

• Gene Name: CALCR calcitonin receptor [ Homo sapiens ]
• Official Symbol: CALCR
• Synonyms: CALCR; calcitonin receptor; CTR
• Gene ID: 799
• mRNA Refseq: NM_001164737
• Protein Refseq: NP_001158209
• MIM: 114131
• Uniprot ID: P30988
• Chromosome Location: 7q21.3
• Pathway: Calcitonin-like ligand receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem
• Function: calcitonin binding; NOT calcitonin binding; calcitonin binding; calcitonin receptor activity; calcitonin receptor activity