Recombinant Human CA8 protein, GST-tagged

• Cat.No.: CA8-2618H
• Product Overview: Recombinant Human CA8 protein(P35219)(1-290aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 60 kDa
• Protein length: 1-290aa
• AA Sequence: MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CA8 carbonic anhydrase VIII [ Homo sapiens ]
• Official Symbol: CA8
• Synonyms: CA8; carbonic anhydrase VIII; CALS; carbonic anhydrase-related protein; CARP; CA-related protein; carbonate dehydratase; carbonic anhydrase-like sequence; CAMRQ3; CA-VIII; MGC99509; MGC120502
• Gene ID: 767
• mRNA Refseq: NM_004056
• Protein Refseq: NP_004047
• MIM: 114815
• UniProt ID: P35219