Recombinant Human CA3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CA3-3283H |
Product Overview : | CA3 MS Standard C13 and N15-labeled recombinant protein (NP_005172) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns. |
Molecular Mass : | 29.6 kDa |
AA Sequence : | MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CA3 carbonic anhydrase 3 [ Homo sapiens (human) ] |
Official Symbol | CA3 |
Synonyms | CA3; carbonic anhydrase III, muscle specific; carbonic anhydrase 3; CAIII; Car3; CA-III; carbonate dehydratase III; FLJ36434; |
Gene ID | 761 |
mRNA Refseq | NM_005181 |
Protein Refseq | NP_005172 |
MIM | 114750 |
UniProt ID | P07451 |
◆ Recombinant Proteins | ||
CAR3-1132R | Recombinant Rat CAR3 Protein | +Inquiry |
CA3-480H | Recombinant Human CA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CA3-1143H | Active Recombinant Human CA3 protein, His-tagged | +Inquiry |
CA3-0239H | Recombinant Human CA3 Protein, GST-Tagged | +Inquiry |
CA3-10620H | Recombinant Human CA3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA3-7914HCL | Recombinant Human CA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA3 Products
Required fields are marked with *
My Review for All CA3 Products
Required fields are marked with *
0
Inquiry Basket