Recombinant Human CA3 Protein, His-tagged

Cat.No. : CA3-0188H
Product Overview : Recombinant Human CA3 protein(Ala2-Lys260), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ala2-Lys260
Tag : C-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 31 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFKAHHHHHHHHHH
Gene Name CA3 carbonic anhydrase III, muscle specific [ Homo sapiens ]
Official Symbol CA3
Synonyms CA3; carbonic anhydrase III, muscle specific; carbonic anhydrase 3; CAIII; Car3; CA-III; carbonate dehydratase III; FLJ36434;
Gene ID 761
mRNA Refseq NM_005181
Protein Refseq NP_005172
MIM 114750
UniProt ID P07451

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CA3 Products

Required fields are marked with *

My Review for All CA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon