Recombinant Human CA12 Protein, GST-Tagged

• Cat.No.: CA12-0233H
• Product Overview: Human CA12 full-length ORF (NP_001209.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Three transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 65.9 kDa
• AA Sequence: MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CA12 carbonic anhydrase XII [ Homo sapiens ]
• Official Symbol: CA12
• Synonyms: CA12; carbonic anhydrase XII; carbonic anhydrase 12; HsT18816; CA-XII; carbonic dehydratase; carbonate dehydratase XII; tumor antigen HOM-RCC-3.1.3; CAXII; FLJ20151
• Gene ID: 771
• mRNA Refseq: NM_001218
• Protein Refseq: NP_001209
• MIM: 603263
• UniProt ID: O43570