Recombinant Human CA12

Cat.No. : CA12-26248TH
Product Overview : Recombinant fragment corresponding to amino acids 25-124 of Human CA12 with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. O43570,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Highly expressed in colon, kidney, prostate, intestine and activated lymphocytes. Expressed at much higher levels in the renal cell cancers than in surrounding normal kidney tissue. Moderately expressed in pancreas, ovary and testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN
Sequence Similarities : Belongs to the alpha-carbonic anhydrase family.
Gene Name CA12 carbonic anhydrase XII [ Homo sapiens ]
Official Symbol CA12
Synonyms CA12; carbonic anhydrase XII; carbonic anhydrase 12; HsT18816;
Gene ID 771
mRNA Refseq NM_001218
Protein Refseq NP_001209
MIM 603263
Uniprot ID O43570
Chromosome Location 15q22
Pathway Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem;
Function carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CA12 Products

Required fields are marked with *

My Review for All CA12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon