Recombinant Human C20orf202 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C20orf202-6022H
Product Overview : C20orf202 MS Standard C13 and N15-labeled recombinant protein (NP_001009612) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : C20orf202 (Chromosome 20 Open Reading Frame 202) is a Protein Coding gene. An important paralog of this gene is FAM167B.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 13.4 kDa
AA Sequence : MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHLHSVLEELRADSAHWEDARSSGGTSPIRARAGSEGRGCQPVCSRGLAQLLRGEDSRRSSLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C20orf202 chromosome 20 open reading frame 202 [ Homo sapiens (human) ]
Official Symbol C20orf202
Synonyms C20orf202; chromosome 20 open reading frame 202; uncharacterized protein C20orf202
Gene ID 400831
mRNA Refseq NM_001009612
Protein Refseq NP_001009612
UniProt ID A1L168

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C20orf202 Products

Required fields are marked with *

My Review for All C20orf202 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon