Recombinant Human C1QTNF5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C1QTNF5-1834H
• Product Overview: C1QTNF5 MS Standard C13 and N15-labeled recombinant protein (NP_056460) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of a family of proteins that function as components of basement membranes and may play a role in cell adhesion. Mutations in this gene have been associated with late-onset retinal degeneration. The protein may be encoded by either a bicistronic transcript including sequence from the upstream membrane frizzled-related protein gene (MFRP), or by a monocistronic transcript expressed from an internal promoter.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 25.3 kDa
• AA Sequence: MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGRPGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C1QTNF5 C1q and tumor necrosis factor related protein 5 [ Homo sapiens (human) ]
• Official Symbol: C1QTNF5
• Synonyms: C1QTNF5; C1q and tumor necrosis factor related protein 5; complement C1q tumor necrosis factor-related protein 5; complement C1q tumor necrosis factor related protein 5 precursor variant 3; complement c1q tumor necrosis factor related protein 5; CTRP5; DKFZp586B0621; LORD; FLJ30570
• Gene ID: 114902
• mRNA Refseq: NM_015645
• Protein Refseq: NP_056460
• MIM: 608752
• UniProt ID: Q9BXJ0