Recombinant Human C1orf218 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C1orf218-6424H
• Product Overview: C1orf218 MS Standard C13 and N15-labeled recombinant protein (NP_061922) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Clathrin-mediated endocytosis is a major mechanism for internalization of proteins and lipids. Members of the connecdenn family, such as DENND1B, function as guanine nucleotide exchange factors (GEFs) for the early endosomal small GTPase RAB35 and bind to clathrin and clathrin adaptor protein-2. Thus, connecdenns link RAB35 activation with the clathrin machinery.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 37.3 kDa
• AA Sequence: MTKATPAVRTAYKFAKNHAKLGLKEVKSKLKHKENEEDYGTCSSSVQYTPVYKLHNEKGGNSEKRKLAQARLKRPLKSLDGALYDDEDDDDIERASKLSSEDGEEASAYLYESDDSVETRVKTPYSGEMDLLGEILDTLSTHSSDQGKLAAAKSLDFFRSMDDIDYKPTNKSNAPSENNLAFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTDKGKTEKRETLSQISDDLLIPGLGRHSSTFVPWEKEGKEAKETSEDIGLLHEVVSLCHMTSDFQQSLNISDKNTNGNQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C1orf218 chromosome 1 open reading frame 218 [ Homo sapiens (human) ]
• Official Symbol: C1orf218
• Synonyms: C1orf218; chromosome 1 open reading frame 218; FLJ20054; DKFZp547O0715
• Gene ID: 54530
• mRNA Refseq: NM_019049
• Protein Refseq: NP_061922