Recombinant Human C19orf25 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C19orf25-4982H
Product Overview : C19orf25 MS Standard C13 and N15-labeled recombinant protein (NP_689695) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : C19orf25 (Chromosome 19 Open Reading Frame 25) is a Protein Coding gene.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 12.7 kDa
AA Sequence : MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFRMMEDAEAPGEQLYQQSRAYVAANQRLQQAGNVPRLPPQADLSGPAGLGSAQGGLHPGFPWGSVGPRLAFTGSQPTWVLTQAPLLMLGLRFIRRLIHAELVGPTQLAPSCVTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C19orf25 chromosome 19 open reading frame 25 [ Homo sapiens (human) ]
Official Symbol C19orf25
Synonyms C19orf25; chromosome 19 open reading frame 25; UPF0449 protein C19orf25
Gene ID 148223
mRNA Refseq NM_152482
Protein Refseq NP_689695
UniProt ID Q9UFG5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C19orf25 Products

Required fields are marked with *

My Review for All C19orf25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon