Recombinant Human C11orf72 Protein, GST-tagged

• Cat.No.: C11orf72-483H
• Product Overview: Human C11orf72 full-length ORF ( NP_775849.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 54.3 kDa
• AA Sequence: MTQLPELGLRSPNNKSPTGPHPLEHLLARLLKRRRRSTLMSSPRSLLCSISGPGSHLLSTHPILCHSVYQPPQPASRPQAKRYQGLLPVPLAPHPLCLSGQLYLPNIPCTVIDGCGPVISHLKLTMYPWGLPPSHLGSSSPFSANMEQWDYYKSQTRFAPFLPESFCGSPLPSEQSSRPFGLAFKVLCAATCQPPQFQLLWLCPYKLDLHQRICLPPNLALVLLGALWTSPPPGSFLQPPYNRPYKLYKTN
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf72 chromosome 11 open reading frame 72 [ Homo sapiens (human) ]
• Official Symbol: C11orf72
• Synonyms: C11orf72
• Gene ID: 100505621
• mRNA Refseq: NM_173578.1
• Protein Refseq: NP_775849.1
• UniProt ID: Q8NBR9.1