Recombinant Human C10orf25 Protein, GST-tagged

• Cat.No.: C10orf25-423H
• Product Overview: Human C10orf25 full-length ORF (BAB70858.1, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.82 kDa
• AA Sequence: MVPGPPESVVRFFLWFCFLLPPTRKASCDPRDLKSCNRPCVWSRLLKPNSSLSNLETAYFPQNLRFLRPWYFSRSHLNYHQKAPARWEWLYSIYRKGTKAQRRNVLRSPCAPPQPSWPCSVI
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C10orf25 chromosome 10 open reading frame 25 [ Homo sapiens (human) ]
• Official Symbol: C10orf25
• Synonyms: C10orf25
• Gene ID: 220979
• mRNA Refseq: NM_001039380.3
• Protein Refseq: NP_001034469.2
• UniProt ID: Q5T742.3