Recombinant Human BUB1B

• Cat.No.: BUB1B-26124TH
• Product Overview: Recombinant fragment of Human BubR1 with a N terminal proprietary tag; predicted molecular weight 39.93 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 130 amino acids
• Description: This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer.
• Molecular Weight: 39.930kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMST LQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDR YISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPR FLNLWLKLGR

Gene Information

• Gene Name: BUB1B budding uninhibited by benzimidazoles 1 homolog beta (yeast) [ Homo sapiens ]
• Official Symbol: BUB1B
• Synonyms: BUB1B; budding uninhibited; budding uninhibited by benzimidazoles 1 (yeast homolog), beta; mitotic checkpoint serine/threonine-protein kinase BUB1 beta; Bub1A; BUBR1; MAD3L; SSK1
• Gene ID: 701
• mRNA Refseq: NM_001211
• Protein Refseq: NP_001202
• MIM: 602860
• Uniprot ID: O60566
• Chromosome Location: 15q15
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem
• Function: ATP binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity