Recombinant Human BTNL2 Full Length Transmembrane protein, His-tagged
Cat.No. : | BTNL2-103H |
Product Overview : | Recombinant Human BTNL2(Lys24-Trp455) fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-455aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.3 kDa |
AA Sequence : | MVDFPGYNLSGAVASFLFILLTMKQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BTNL2 butyrophilin-like 2 (MHC class II associated) [ Homo sapiens ] |
Official Symbol | BTNL2 |
Synonyms | SS2; BTL-II; HSBLMHC1 |
Gene ID | 56244 |
mRNA Refseq | NM_019602.1 |
Protein Refseq | NP_062548.1 |
MIM | 606000 |
UniProt ID | Q9UIR0 |
◆ Recombinant Proteins | ||
BTNL2-0799H | Recombinant Human BTNL2 Protein (Ser26-Gly454), C-His tagged | +Inquiry |
Btnl2-4966M | Recombinant Mouse Btnl2 Protein (Asp27-Gly453), C-His tagged | +Inquiry |
BTNL2-0801H | Recombinant Human BTNL2 Protein (Glu27-Ser453), N-His tagged | +Inquiry |
BTNL2-34H | Recombinant Human BTNL2 Protein, Fc-tagged | +Inquiry |
BTNL2-2033H | Active Recombinant Human BTNL2, MIgG2a Fc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTNL2 Products
Required fields are marked with *
My Review for All BTNL2 Products
Required fields are marked with *
0
Inquiry Basket