Recombinant Human BTG3 Protein, GST-tagged

• Cat.No.: BTG3-385H
• Product Overview: Human BTG3 full-length ORF ( AAH11957, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two transcript variants encoding different isoforms have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 58.08 kDa
• AA Sequence: MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIMYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPTPVTWVPPPGMHCDRNHWINPHMLAPH
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BTG3 BTG family, member 3 [ Homo sapiens ]
• Official Symbol: BTG3
• Synonyms: BTG3; BTG family, member 3; protein BTG3; ANA; tob55; protein Tob5; B-cell translocation gene 3; abundant in neuroepithelium area protein; TOB5; TOFA; TOB55; MGC8928
• Gene ID: 10950
• mRNA Refseq: NM_001130914
• Protein Refseq: NP_001124386
• MIM: 605674
• UniProt ID: Q14201