Recombinant Human BTF3L4 Protein, GST-tagged

• Cat.No.: BTF3L4-381H
• Product Overview: Human BTF3L4 full-length ORF ( NP_689478.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.7 kDa
• AA Sequence: MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BTF3L4 basic transcription factor 3-like 4 [ Homo sapiens ]
• Official Symbol: BTF3L4
• Synonyms: BTF3L4; basic transcription factor 3-like 4; transcription factor BTF3 homolog 4; MGC23908; MGC88389
• Gene ID: 91408
• mRNA Refseq: NM_001136497
• Protein Refseq: NP_001129969
• UniProt ID: Q96K17