Recombinant Human BRMS1L Protein, GST-tagged

• Cat.No.: BRMS1L-342H
• Product Overview: Human BRMS1L full-length ORF ( NP_115728.2, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene shows sequence similarity to the human breast carcinoma metastasis suppressor (BRMS1) protein and the mammalian Sds3 (suppressor of defective silencing 3) proteins. This protein is a component of the mSin3a family of histone deacetylase complexes (HDAC).
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 64 kDa
• AA Sequence: MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BRMS1L breast cancer metastasis-suppressor 1-like [ Homo sapiens ]
• Official Symbol: BRMS1L
• Synonyms: BRMS1L; breast cancer metastasis-suppressor 1-like; breast cancer metastasis suppressor 1 , BRMS1; breast cancer metastasis-suppressor 1-like protein; FLJ39177; MGC11296; BRMS1-like protein p40; BRMS1-homolog protein p40; BRMS1
• Gene ID: 84312
• mRNA Refseq: NM_032352
• Protein Refseq: NP_115728
• UniProt ID: Q5PSV4