Recombinant Human BRDT protein, His-tagged
Cat.No. : | BRDT-2755H |
Product Overview : | Recombinant Human BRDT protein(793 - 926 aa), fused to His tag, was expressed in E. coli. |
Availability | April 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 793 - 926 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MPVQKDIKIKNADSWKSLGKPVKPSGVMKSSDELFNQFRKAAIEKEVKARTQELIRKHLEQNTKELKASQENQRDLGNGLTVESFSNKIQNKCSGEEQKEHQQSSEAQDKSKLWLLKDRDLARQKEQERRRREAM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BRDT bromodomain, testis-specific [ Homo sapiens ] |
Official Symbol | BRDT |
Synonyms | BRDT; bromodomain, testis-specific; bromodomain testis-specific protein; BRD6; cancer/testis antigen 9; CT9; RING3-like protein; |
Gene ID | 676 |
mRNA Refseq | NM_001242805 |
Protein Refseq | NP_001229734 |
MIM | 602144 |
UniProt ID | Q58F21 |
◆ Recombinant Proteins | ||
BRDT-1915H | Recombinant Human BRDT, His-tagged | +Inquiry |
BRDT-37H | Active Recombinant Human BRDT, His&FLAG-tagged | +Inquiry |
BRDT-2489M | Recombinant Mouse BRDT Protein | +Inquiry |
BRDT-2322H | Recombinant Human BRDT protein, GST-tagged | +Inquiry |
BRDT-59H | Recombinant Human BRDT protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRDT Products
Required fields are marked with *
My Review for All BRDT Products
Required fields are marked with *
0
Inquiry Basket