Recombinant Human BRD8 Protein, GST-tagged

• Cat.No.: BRD8-332H
• Product Overview: Human BRD8 partial ORF ( NP_631938, 33 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Three alternatively spliced transcript variants that encode distinct isoforms have been identified.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.3 kDa
• AA Sequence: RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BRD8 bromodomain containing 8 [ Homo sapiens ]
• Official Symbol: BRD8
• Synonyms: BRD8; bromodomain containing 8; bromodomain-containing protein 8; p120; SMAP; trCP120; skeletal muscle abundant protein 2; thyroid hormone receptor coactivating protein of 120 kDa; SMAP2
• Gene ID: 10902
• mRNA Refseq: NM_001164326
• Protein Refseq: NP_001157798
• MIM: 602848
• UniProt ID: Q9H0E9