Recombinant Human BORCS7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BORCS7-6043H
• Product Overview: C10orf32 MS Standard C13 and N15-labeled recombinant protein (NP_653192) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: BORCS7 (BLOC-1 Related Complex Subunit 7) is a Protein Coding gene. Diseases associated with BORCS7 include Leopard Syndrome 1 and Breast Apocrine Carcinoma. An important paralog of this gene is BORCS7-ASMT.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.6 kDa
• AA Sequence: MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BORCS7 BLOC-1 related complex subunit 7 [ Homo sapiens (human) ]
• Official Symbol: BORCS7
• Synonyms: BORCS7; BLOC-1 related complex subunit 7; C10orf32; FLJ40752; MGC27171; DKFZp686B2219; BLOC-1-related complex subunit 7; UPF0693 protein C10orf32; diaskedin
• Gene ID: 119032
• mRNA Refseq: NM_144591
• Protein Refseq: NP_653192
• MIM: 616600
• UniProt ID: Q96B45