Recombinant Human BORCS5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BORCS5-2716H
• Product Overview: LOH12CR1 MS Standard C13 and N15-labeled recombinant protein (NP_477517) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Thereby, it may indirectly play a role in cell spreading and motility.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.2 kDa
• AA Sequence: MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BORCS5 BLOC-1 related complex subunit 5 [ Homo sapiens (human) ]
• Official Symbol: BORCS5
• Synonyms: BORCS5; BLOC-1 related complex subunit 5; LOH12CR1; LOH1CR12; BLOC-1-related complex subunit 5; loss of heterozygosity 12 chromosomal region 1 protein; loss of heterozygosity, 12, chromosomal region 1; myristoylated lysosomal protein; myrlysin
• Gene ID: 118426
• mRNA Refseq: NM_058169
• Protein Refseq: NP_477517
• MIM: 616598
• UniProt ID: Q969J3