Recombinant Human BOLA1 Protein (1-137 aa), His-tagged
Cat.No. : | BOLA1-1343H |
Product Overview : | Recombinant Human BOLA1 Protein (1-137 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-137 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.3 kDa |
AA Sequence : | MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | BOLA1 bolA homolog 1 (E. coli) [ Homo sapiens ] |
Official Symbol | BOLA1 |
Synonyms | BOLA1; CGI 143; hBolA; CGI-143; MGC75015; RP11-196G18.18; |
Gene ID | 51027 |
mRNA Refseq | NM_016074 |
Protein Refseq | NP_057158 |
MIM | 613181 |
UniProt ID | Q9Y3E2 |
◆ Recombinant Proteins | ||
BOLA1-10267H | Recombinant Human BOLA1, His-tagged | +Inquiry |
BOLA1-3763HF | Recombinant Full Length Human BOLA1 Protein, GST-tagged | +Inquiry |
BOLA1-380R | Recombinant Rhesus Macaque BOLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BOLA1-552R | Recombinant Rhesus monkey BOLA1 Protein, His-tagged | +Inquiry |
BOLA1-1066M | Recombinant Mouse BOLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BOLA1-173HCL | Recombinant Human BOLA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BOLA1 Products
Required fields are marked with *
My Review for All BOLA1 Products
Required fields are marked with *
0
Inquiry Basket