Recombinant Human BOLA1 Protein (1-137 aa), His-tagged

• Cat.No.: BOLA1-1343H
• Product Overview: Recombinant Human BOLA1 Protein (1-137 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-137 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.3 kDa
• AA Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: BOLA1 bolA homolog 1 (E. coli) [ Homo sapiens ]
• Official Symbol: BOLA1
• Synonyms: BOLA1; CGI 143; hBolA; CGI-143; MGC75015; RP11-196G18.18
• Gene ID: 51027
• mRNA Refseq: NM_016074
• Protein Refseq: NP_057158
• MIM: 613181
• UniProt ID: Q9Y3E2