Recombinant Human BOK Protein, GST-tagged

Cat.No. : BOK-299H
Product Overview : Human BOK partial ORF ( AAH17214, 95 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains all four BCL-2 like domains (BH1, 2, 3 and 4) and is a pro-apoptotic BCL-2 protein identified in the ovary.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 38.61 kDa
AA Sequence : SLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BOK BCL2-related ovarian killer [ Homo sapiens ]
Official Symbol BOK
Synonyms BOK; BCL2-related ovarian killer; bcl-2-related ovarian killer protein; BCL2L9; BOKL; MGC4631; hBOK; bcl2-L-9; bcl-2-like protein 9;
Gene ID 666
mRNA Refseq NM_032515
Protein Refseq NP_115904
MIM 605404
UniProt ID Q9UMX3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BOK Products

Required fields are marked with *

My Review for All BOK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon