Recombinant Human BMPR2 protein(741-870 aa), C-His-tagged
Cat.No. : | BMPR2-2863H |
Product Overview : | Recombinant Human BMPR2 protein(Q13873)(741-870 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 741-870 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGEDTRLNINSSPDEHEPL |
Gene Name | BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) [ Homo sapiens ] |
Official Symbol | BMPR2 |
Synonyms | BMPR2; bone morphogenetic protein receptor, type II (serine/threonine kinase); PPH1, primary pulmonary hypertension 1; bone morphogenetic protein receptor type-2; BMPR II; BMPR3; BRK 3; T ALK; BMPR-2; BMP type-2 receptor; BMP type II receptor; type II activin receptor-like kinase; bone morphogenetic protein receptor type II; type II receptor for bone morphogenetic protein-4; BMR2; PPH1; BRK-3; T-ALK; BMPR-II; FLJ41585; FLJ76945; |
Gene ID | 659 |
mRNA Refseq | NM_001204 |
Protein Refseq | NP_001195 |
MIM | 600799 |
UniProt ID | Q13873 |
◆ Recombinant Proteins | ||
Bmpr2-715M | Recombinant Mouse Bmpr2 Protein, MYC/DDK-tagged | +Inquiry |
BMPR2-287H | Recombinant Human BMPR2 Protein, GST-tagged | +Inquiry |
BMPR2-577H | Recombinant Human BMPR2 protein, His & T7-tagged | +Inquiry |
BMPR2-870H | Recombinant Human BMPR2 Protein, Fc/His-tagged | +Inquiry |
BMPR2-1060M | Recombinant Mouse BMPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMPR2-2717HCL | Recombinant Human BMPR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMPR2 Products
Required fields are marked with *
My Review for All BMPR2 Products
Required fields are marked with *
0
Inquiry Basket