Recombinant Human BMPR1B protein, His-tagged

Cat.No. : BMPR1B-318H
Product Overview : Recombinant Human BMPR1B protein(NP_001194)(16-57 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 16-57 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name BMPR1B bone morphogenetic protein receptor, type IB [ Homo sapiens ]
Official Symbol BMPR1B
Synonyms BMPR1B; bone morphogenetic protein receptor, type IB; bone morphogenetic protein receptor type-1B; ALK6; CDw293; BMPR-1B; BMP type-1B receptor; activin receptor-like kinase 6; serine/threonine receptor kinase; ALK-6;
Gene ID 658
mRNA Refseq NM_001203
Protein Refseq NP_001194
MIM 603248
UniProt ID O00238

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BMPR1B Products

Required fields are marked with *

My Review for All BMPR1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon