Recombinant Human BMP8A Protein, GST-tagged

Cat.No. : BMP8A-276H
Product Overview : Human BMP8A partial ORF ( NP_861525.1, 112 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.41 kDa
AA Sequence : VERDRALGHQEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BMP8A bone morphogenetic protein 8a [ Homo sapiens ]
Official Symbol BMP8A
Synonyms BMP8A; bone morphogenetic protein 8a; bone morphogenetic protein 8A; BMP-8A; FLJ14351; FLJ45264;
Gene ID 353500
mRNA Refseq NM_181809
Protein Refseq NP_861525
UniProt ID Q7Z5Y6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BMP8A Products

Required fields are marked with *

My Review for All BMP8A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon