Recombinant Human BMP7 protein

Description :	Bone Morphogenetic Protein 7 is one of the BMPs, some of which belong to the TGF-beta superfamily (BMP2-7). There are more than thirteen BMPs have been discovered nowadays and they are involved in inducing cartilage and bone formation. BMP-7 is mainly expressed in kidney and bladder. It is also present in developing eyes, brain and ear during embryogenesis. BMP-7 also named osteogenic protein-1 (OP-1) is a potent osteoinductive cytokine and plays role in osteoblast differentiation, SMAD1 production and renal development and repair. Human BMP-7 is synthesized with a signal sequence (29 a.a.), a propeptide (263 a.a.), and a growth factor domain (139 a.a.). The growth factor domain of human BMP-7 shares 98 % a.a. sequence identity with mouse and rat BMP-7.
Source :	E.coli
Species :	Human
Form :	Lyophilized from a 0.2μm filtered concentrated solution in 30 % acetonitrile, 0.1 % TFA.
Molecular Mass :	Approximately 15.7 kDa, a monomeric, non-glycosylated polypeptide chain containing 139 amino acids.
Protein length :	139
AA Sequence :	STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Endotoxin :	Less than 1 EU/μg of rHuBMP-7 as determined by LAL method.
Purity :	>95% by SDS-PAGE and HPLC analysis.
Applications :	Molecular standard (Western, ELISA) in studying secreted BMP-7; Preparing antibodies for BMP-7 monomer; Molecule standard in detecting secreted BMP-7 in reduced SDS-PAGE.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10 mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag :	Non

Gene Name	BMP7
Official Symbol	BMP7
Synonyms	BMP7; bone morphogenetic protein 7; OP 1; osteogenic protein 1; BMP-7; OP-1;
Gene ID	655
mRNA Refseq	NM_001719
Protein Refseq	NP_001710
MIM	112267
UniProt ID	P18075