Recombinant Human BMP15 protein, His&Myc-tagged

Cat.No. : BMP15-821H
Product Overview : Recombinant Human BMP15 protein(O95972)(268-392aa), fused to N-terminal His and C-terminal Myc tags, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 268-392aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 21.4 kDa
AA Sequence : QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name BMP15 bone morphogenetic protein 15 [ Homo sapiens ]
Official Symbol BMP15
Synonyms BMP15; bone morphogenetic protein 15; GDF9B; BMP-15; GDF-9B; growth/differentiation factor 9B; ODG2; POF4;
Gene ID 9210
mRNA Refseq NM_005448
Protein Refseq NP_005439
MIM 300247
UniProt ID O95972

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BMP15 Products

Required fields are marked with *

My Review for All BMP15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon