Recombinant Human BMI1 Protein, His tagged

• Cat.No.: BMI1-771H
• Product Overview: Recombinant Human BMI1 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.
• Molecular Mass: The protein has a calculated MW of 39 kDa.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.15 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH 7.4

Gene Information

• Gene Name: BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ]
• Official Symbol: BMI1
• Synonyms: BMI1; BMI1 polycomb ring finger oncogene; B lymphoma Mo MLV insertion region 1 homolog (mouse), PCGF4, polycomb group ring finger 4; polycomb complex protein BMI-1; RNF51; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; B lymphoma Mo-MLV insertion region 1 homolog; murine leukemia viral (bmi-1) oncogene homolog; PCGF4; FLVI2/BMI1; MGC12685
• Gene ID: 648
• mRNA Refseq: NM_005180
• Protein Refseq: NP_005171
• MIM: 164831
• UniProt ID: P35226