Recombinant Human BMI1 protein(101-170 aa), C-His-tagged

• Cat.No.: BMI1-2733H
• Product Overview: Recombinant Human BMI1 protein(P35226)(101-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 101-170 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: HPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAM

Gene Information

• Gene Name: BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ]
• Official Symbol: BMI1
• Synonyms: BMI1; BMI1 polycomb ring finger oncogene; B lymphoma Mo MLV insertion region 1 homolog (mouse) , PCGF4, polycomb group ring finger 4; polycomb complex protein BMI-1; RNF51; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; B lymphoma Mo-MLV insertion region 1 homolog; murine leukemia viral (bmi-1) oncogene homolog; PCGF4; FLVI2/BMI1; MGC12685
• Gene ID: 648
• mRNA Refseq: NM_005180
• Protein Refseq: NP_005171
• MIM: 164831
• UniProt ID: P35226