Recombinant Human BFSP1 Protein, GST-tagged
Cat.No. : | BFSP1-203H |
Product Overview : | Human BFSP1 partial ORF ( NP_001186, 567 a.a. - 664 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and the protein product of this gene, filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF). Mutations in this gene are the cause of autosomal recessive cortical juvenile-onset cataract. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | EESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKS |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BFSP1 beaded filament structural protein 1, filensin [ Homo sapiens ] |
Official Symbol | BFSP1 |
Synonyms | BFSP1; beaded filament structural protein 1, filensin; filensin; CP94; CP115; LIFL H; cytoskeletal protein, 115 KD; lens intermediate filament-like heavy; lens fiber cell beaded-filament structural protein CP 115; LIFL-H; |
Gene ID | 631 |
mRNA Refseq | NM_001161705 |
Protein Refseq | NP_001155177 |
MIM | 603307 |
UniProt ID | Q12934 |
◆ Recombinant Proteins | ||
BFSP1-203H | Recombinant Human BFSP1 Protein, GST-tagged | +Inquiry |
BFSP1-1021M | Recombinant Mouse BFSP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Bfsp1-705M | Recombinant Mouse Bfsp1 Protein, MYC/DDK-tagged | +Inquiry |
BFSP1-975R | Recombinant Rat BFSP1 Protein | +Inquiry |
BFSP1-2388M | Recombinant Mouse BFSP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BFSP1-64HCL | Recombinant Human BFSP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BFSP1 Products
Required fields are marked with *
My Review for All BFSP1 Products
Required fields are marked with *
0
Inquiry Basket