Recombinant Human BFSP1 Protein, GST-tagged

Description :	More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and the protein product of this gene, filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF). Mutations in this gene are the cause of autosomal recessive cortical juvenile-onset cataract. Multiple transcript variants encoding different isoforms have been found for this gene.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	36.52 kDa
AA Sequence :	EESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKS
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	BFSP1 beaded filament structural protein 1, filensin [ Homo sapiens ]
Official Symbol	BFSP1
Synonyms	BFSP1; beaded filament structural protein 1, filensin; filensin; CP94; CP115; LIFL H; cytoskeletal protein, 115 KD; lens intermediate filament-like heavy; lens fiber cell beaded-filament structural protein CP 115; LIFL-H;
Gene ID	631
mRNA Refseq	NM_001161705
Protein Refseq	NP_001155177
MIM	603307
UniProt ID	Q12934