Recombinant Human BEX3 Protein (1-111 aa), His-tagged

• Cat.No.: BEX3-1474H
• Product Overview: Recombinant Human BEX3 Protein (1-111 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Apoptosis. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 1-111 aa
• Description: May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 15.0 kDa
• AA Sequence: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: BEX3 brain expressed X-linked 3 [ Homo sapiens (human) ]
• Official Symbol: BEX3
• Synonyms: Bex; NADE; HGR74; NGFRAP1; DXS6984E
• Gene ID: 27018
• mRNA Refseq: NM_206915
• Protein Refseq: NP_996798
• UniProt ID: Q00994