Recombinant Human betacoronavirus 2c EMC/2012 Spike protein, His-sumostar-tagged
Cat.No. : | Spike-4527H |
Product Overview : | Recombinant Human betacoronavirus 2c EMC/2012 Spike protein(K0BRG7)(367-606aa), fused to N-terminal His tag and sumostar tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Source : | Yeast |
Species : | Human betacoronavirus 2c EMC/2012 |
Tag : | His&SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.2 kDa |
Protein length : | 367-606aa |
AA Sequence : | EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Spike Products
Required fields are marked with *
My Review for All Spike Products
Required fields are marked with *
0
Inquiry Basket