Recombinant Human BEND5 Protein, GST-tagged

• Cat.No.: BEND5-193H
• Product Overview: Human BEND5 full-length ORF ( AAH11804.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 55.6 kDa
• AA Sequence: MDSLEDAVVPRALYEELLRNYQQQQEEMRHLQQELERTRRQLVQQAKKLKEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSGIWVDEEKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKKKKDAVPKPPLSPHKLSIVRECLYDRIAQETVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNLQ
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BEND5 BEN domain containing 5 [ Homo sapiens (human) ]
• Official Symbol: BEND5
• Synonyms: BEN domain-containing protein 5; Bend5; BEND5_HUMAN; C1orf165; chromosome 1 open reading frame 165; FLJ11588; BEND5
• Gene ID: 79656
• mRNA Refseq: NM_024603.2
• Protein Refseq: NP_078879.2
• UniProt ID: Q7L4P6