Recombinant Human BECN1 Protein, GST-tagged

Cat.No. : BECN1-190H
Product Overview : Human BECN1 partial ORF ( AAH10276, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BECN1 beclin 1, autophagy related [ Homo sapiens ]
Official Symbol BECN1
Synonyms BECN1; beclin 1, autophagy related; beclin 1 (coiled coil, moesin like BCL2 interacting protein); beclin-1; ATG6; ATG6 autophagy related 6 homolog (S. cerevisiae); VPS30; ATG6 autophagy related 6 homolog; coiled-coil myosin-like BCL2-interacting protein;
Gene ID 8678
mRNA Refseq NM_003766
Protein Refseq NP_003757
MIM 604378
UniProt ID Q14457

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BECN1 Products

Required fields are marked with *

My Review for All BECN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon