Recombinant Human BECN1 Protein, GST-tagged

• Cat.No.: BECN1-190H
• Product Overview: Human BECN1 partial ORF ( AAH10276, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BECN1 beclin 1, autophagy related [ Homo sapiens ]
• Official Symbol: BECN1
• Synonyms: BECN1; beclin 1, autophagy related; beclin 1 (coiled coil, moesin like BCL2 interacting protein); beclin-1; ATG6; ATG6 autophagy related 6 homolog (S. cerevisiae); VPS30; ATG6 autophagy related 6 homolog; coiled-coil myosin-like BCL2-interacting protein
• Gene ID: 8678
• mRNA Refseq: NM_003766
• Protein Refseq: NP_003757
• MIM: 604378
• UniProt ID: Q14457