Recombinant Human BDNF Protein, His-tagged

• Cat.No.: BDNF-22H
• Product Overview: Recombinant Human BDNF Protein (Ala19–Arg128) was expressed in HEK293 cells with C-terminal His tag.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 19-128 a.a.
• Form: Lyophilized (freeze-dried) powder
• Molecular Mass: 13.1 kDa
• AA Sequence: APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH
• Endotoxin: < 1.0 EU/µg
• Purity: > 95 %
• Storage: Store lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
• Storage Buffer: phosphate buffered saline.
• Reconstitution: Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

Gene Information

• Gene Name: BDNF brain-derived neurotrophic factor [ Homo sapiens ]
• Official Symbol: BDNF
• Synonyms: BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632
• Gene ID: 627
• mRNA Refseq: NM_001143805
• Protein Refseq: NP_001137277
• MIM: 113505
• UniProt ID: P23560