Recombinant Human BDNF Protein, His-tagged
Cat.No. : | BDNF-22H |
Product Overview : | Recombinant Human BDNF Protein (Ala19–Arg128) was expressed in HEK293 cells with C-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-128 a.a. |
Form : | Lyophilized (freeze-dried) powder |
Molecular Mass : | 13.1 kDa |
AA Sequence : | APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH |
Endotoxin : | < 1.0 EU/µg |
Purity : | > 95 % |
Storage : | Store lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week. |
Storage Buffer : | phosphate buffered saline. |
Reconstitution : | Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. |
Gene Name | BDNF brain-derived neurotrophic factor [ Homo sapiens ] |
Official Symbol | BDNF |
Synonyms | BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632; |
Gene ID | 627 |
mRNA Refseq | NM_001143805 |
Protein Refseq | NP_001137277 |
MIM | 113505 |
UniProt ID | P23560 |
◆ Recombinant Proteins | ||
BDNF-08H | Recombinant Active Human BDNF Protein, His-tagged(C-ter) | +Inquiry |
BDNF-334H | Recombinant Human Brain-derived Neurotrophic Factor | +Inquiry |
BDNF-72H | Recombinant Human BDNF protein | +Inquiry |
BDNF-491H | Recombinant Human BDNF protein, His-tagged | +Inquiry |
BDNF-311C | Recombinant Cattle BDNF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *
0
Inquiry Basket