Recombinant Human BDNF protein, His-SUMO-tagged
Cat.No. : | BDNF-2585H |
Product Overview : | Recombinant Human BDNF protein(P23560)(129-247aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 129-247aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BDNF brain-derived neurotrophic factor [ Homo sapiens ] |
Official Symbol | BDNF |
Synonyms | BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632; |
Gene ID | 627 |
mRNA Refseq | NM_001143805 |
Protein Refseq | NP_001137277 |
MIM | 113505 |
UniProt ID | P23560 |
◆ Recombinant Proteins | ||
BDNF-966R | Recombinant Rat BDNF Protein | +Inquiry |
BDNF-3252C | Recombinant Chicken BDNF | +Inquiry |
BDNF-243H | Recombinant Human BDNF protein, His-tagged | +Inquiry |
BDNF-01H | Recombinant Active Human BDNF Protein, His-tagged | +Inquiry |
BDNF-003H | Active Recombinant Human BDNF | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *
0
Inquiry Basket