Tag :	GST
ProteinLength :	130-179 aa
Tag :	N-GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence :	SDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	BDNF brain-derived neurotrophic factor [ Homo sapiens ]
Official Symbol	BDNF
Synonyms	BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632;
Gene ID	627
mRNA Refseq	NM_001143805
Protein Refseq	NP_001137277
MIM	113505
UniProt ID	P23560

COA

Cat.No. :	BDNF-1855H
Product Overview :	Recombinant Human BDNF protein(130-179 aa), fused with N-terminal GST tag, was expressed in E. coli.

Recombinant Human BDNF protein, GST-tagged