Recombinant Human BCMO1 Protein, GST-tagged

• Cat.No.: BCMO1-171H
• Product Overview: Human BCMO1 partial ORF ( NP_059125.2, 254 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules. [provided by RefSeq]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: RLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTGAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSV
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCMO1 beta-carotene 15,15-monooxygenase 1 [ Homo sapiens ]
• Official Symbol: BCMO1
• Synonyms: BCMO1; beta-carotene 15,15-monooxygenase 1; BCDO, BCDO1, beta carotene 15, 15 dioxygenase 1; beta,beta-carotene 15,15-monooxygenase; BCMO; FLJ10730; beta-carotene dioxygenase 1; beta-carotene 15, 15-dioxygenase 1; BCO; BCDO; BCO1; BCDO1
• Gene ID: 53630
• mRNA Refseq: NM_017429
• Protein Refseq: NP_059125
• MIM: 605748
• UniProt ID: Q9HAY6