Recombinant Human BCL6B Protein, GST-tagged

• Cat.No.: BCL6B-161H
• Product Overview: Human BCL6B partial ORF ( NP_862827, 248 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.52 kDa
• AA Sequence: GPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLA
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL6B B-cell CLL/lymphoma 6, member B (zinc finger protein) [ Homo sapiens ]
• Official Symbol: BCL6B
• Synonyms: BCL6B; B-cell CLL/lymphoma 6, member B (zinc finger protein); B cell CLL/lymphoma 6, member B (zinc finger protein) , zinc finger protein 62 , ZNF62; BAZF; ZBTB28
• Gene ID: 27188
• MIM: 608992
• UniProt ID: Q8N143