Recombinant Human BCL6B Protein, GST-tagged
Cat.No. : | BCL6B-161H |
Product Overview : | Human BCL6B partial ORF ( NP_862827, 248 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | GPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLA |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCL6B B-cell CLL/lymphoma 6, member B (zinc finger protein) [ Homo sapiens ] |
Official Symbol | BCL6B |
Synonyms | BCL6B; B-cell CLL/lymphoma 6, member B (zinc finger protein); B cell CLL/lymphoma 6, member B (zinc finger protein) , zinc finger protein 62 , ZNF62; BAZF; ZBTB28; |
Gene ID | 27188 |
MIM | 608992 |
UniProt ID | Q8N143 |
◆ Recombinant Proteins | ||
BCL6B-2352M | Recombinant Mouse BCL6B Protein | +Inquiry |
BCL6B-160H | Recombinant Human BCL6B Protein, GST-tagged | +Inquiry |
BCL6B-161H | Recombinant Human BCL6B Protein, GST-tagged | +Inquiry |
BCL6B-1548HF | Recombinant Full Length Human BCL6B Protein, GST-tagged | +Inquiry |
BCL6B-997M | Recombinant Mouse BCL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL6B-8478HCL | Recombinant Human BCL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL6B Products
Required fields are marked with *
My Review for All BCL6B Products
Required fields are marked with *
0
Inquiry Basket