Recombinant Human BCCIP Protein, GST-tagged

• Cat.No.: BCCIP-132H
• Product Overview: Human BCCIP partial ORF ( AAH09771, 210 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.96 kDa
• AA Sequence: NKPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKWSFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV
• Purity: Glutathione Sepharose 4 Fast Flow
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCCIP BRCA2 and CDKN1A interacting protein [ Homo sapiens ]
• Official Symbol: BCCIP
• Synonyms: BCCIP; BRCA2 and CDKN1A interacting protein; BRCA2 and CDKN1A-interacting protein; BCCIPalpha; TOK 1; BCCIPbeta; TOK-1beta; TOK-1alpha; protein TOK-1; cdk inhibitor p21 binding protein; p21- and CDK-associated protein 1; BRCA2 and Cip1/p21 interacting protein; TOK1; TOK-1
• Gene ID: 56647
• mRNA Refseq: NM_016567
• Protein Refseq: NP_057651
• MIM: 611883
• UniProt ID: Q9P287