Recombinant Human BCCIP Protein, GST-tagged

Cat.No. : BCCIP-132H
Product Overview : Human BCCIP partial ORF ( AAH09771, 210 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.96 kDa
AA Sequence : NKPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKWSFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCCIP BRCA2 and CDKN1A interacting protein [ Homo sapiens ]
Official Symbol BCCIP
Synonyms BCCIP; BRCA2 and CDKN1A interacting protein; BRCA2 and CDKN1A-interacting protein; BCCIPalpha; TOK 1; BCCIPbeta; TOK-1beta; TOK-1alpha; protein TOK-1; cdk inhibitor p21 binding protein; p21- and CDK-associated protein 1; BRCA2 and Cip1/p21 interacting protein; TOK1; TOK-1;
Gene ID 56647
mRNA Refseq NM_016567
Protein Refseq NP_057651
MIM 611883
UniProt ID Q9P287

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BCCIP Products

Required fields are marked with *

My Review for All BCCIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon