Recombinant Human BCAP31 Protein, GST-tagged

Cat.No. : BCAP31-119H
Product Overview : Human BCAP31 partial ORF ( NP_005736, 137 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome. Two pseudogenes have been identified on chromosome 16. Alternatively spliced transcript variants encoding distinct isoforms have been described although the biological validity of some of the variants has not been determined.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : KKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCAP31 B-cell receptor-associated protein 31 [ Homo sapiens ]
Official Symbol BCAP31
Synonyms BCAP31; B-cell receptor-associated protein 31; 6C6 Ag; BAP31; CDM; DXS1357E; p28 Bap31; BCR-associated protein Bap31; 6C6-AG tumor-associated antigen; 6C6-AG;
Gene ID 10134
mRNA Refseq NM_001139441
Protein Refseq NP_001132913
MIM 300398
UniProt ID P51572

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BCAP31 Products

Required fields are marked with *

My Review for All BCAP31 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon