Recombinant Human BCAP29 Protein, GST-tagged

• Cat.No.: BCAP29-117H
• Product Overview: Human BCAP29 partial ORF ( AAH08478, 125 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 38.50 kDa
• AA Sequence: TQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL
• Purity: Glutathione Sepharose 4 Fast Flow
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCAP29 B-cell receptor-associated protein 29 [ Homo sapiens ]
• Official Symbol: BCAP29
• Synonyms: BCAP29; B-cell receptor-associated protein 29; BAP29; DKFZp686M2086; BCR-associated protein 29; FLJ53907
• Gene ID: 55973
• mRNA Refseq: NM_001008405
• Protein Refseq: NP_001008405
• UniProt ID: Q9UHQ4