Recombinant Human BBS1 Protein

• Cat.No.: BBS1-105H
• Product Overview: Human BBS1 partial ORF ( NP_078925, 187 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Mutations in this gene have been observed in patients with the major form (type 1) of Bardet-Biedl syndrome. The encoded protein may play a role in eye, limb, cardiac and reproductive system development.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.73 kDa
• AA Sequence: NQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGL
• Purity: Glutathione Sepharose 4 Fast Flow
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein length: 187-295 a.a.

Gene Information

• Gene Name: BBS1 Bardet-Biedl syndrome 1 [ Homo sapiens ]
• Official Symbol: BBS1
• Synonyms: BBS1; Bardet-Biedl syndrome 1; Bardet-Biedl syndrome 1 protein; FLJ23590; BBS2-like protein 2; BBS2L2; MGC51114; MGC126183; MGC126184
• Gene ID: 582
• mRNA Refseq: NM_024649
• Protein Refseq: NP_078925
• MIM: 209901
• UniProt ID: Q8NFJ9