Recombinant Human BBS1 Protein

Cat.No. : BBS1-105H
Product Overview : Human BBS1 partial ORF ( NP_078925, 187 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 187-295 a.a.
Description : Mutations in this gene have been observed in patients with the major form (type 1) of Bardet-Biedl syndrome. The encoded protein may play a role in eye, limb, cardiac and reproductive system development.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.73 kDa
AA Sequence : NQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGL
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BBS1 Bardet-Biedl syndrome 1 [ Homo sapiens ]
Official Symbol BBS1
Synonyms BBS1; Bardet-Biedl syndrome 1; Bardet-Biedl syndrome 1 protein; FLJ23590; BBS2-like protein 2; BBS2L2; MGC51114; MGC126183; MGC126184;
Gene ID 582
mRNA Refseq NM_024649
Protein Refseq NP_078925
MIM 209901
UniProt ID Q8NFJ9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BBS1 Products

Required fields are marked with *

My Review for All BBS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon