Recombinant Human BARX2 protein, GST-tagged

• Cat.No.: BARX2-080H
• Product Overview: Human BARX2 partial ORF ( NP_003649, 161 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the homeobox transcription factor family. A highly related protein in mouse has been shown to influence cellular processes that control cell adhesion and remodeling of the actin cytoskeleton in myoblast fusion and chondrogenesis. The encoded protein may also play a role in cancer progression. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: PDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAE
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BARX2 BARX homeobox 2 [ Homo sapiens ]
• Official Symbol: BARX2
• Synonyms: BARX2; BARX homeobox 2; BarH like homeobox 2; homeobox protein BarH-like 2; BarH-like homeobox 2; MGC133368; MGC133369
• Gene ID: 8538
• mRNA Refseq: NM_003658
• Protein Refseq: NP_003649
• MIM: 604823
• UniProt ID: Q9UMQ3