Recombinant Human BARD1 protein, His-tagged

• Cat.No.: BARD1-228H
• Product Overview: Recombinant Human BARD1 protein(NP_000456)(428-777 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 428-777 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: GETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: BARD1 BRCA1 associated RING domain 1 [ Homo sapiens ]
• Official Symbol: BARD1
• Synonyms: BARD1; BRCA1 associated RING domain 1; BRCA1-associated RING domain protein 1; BARD-1; BRCA1-associated RING domain gene 1; BRCA1 associated RING domain 1 isoform eta; BRCA1 associated RING domain 1 isoform phi; BRCA1 associated RING domain 1 isoform alfa; BRCA1 associated RING domain 1 isoform beta; BRCA1 associated RING domain 1 isoform delta; BRCA1 associated RING domain 1 isoform gamma; BRCA1 associated RING domain 1 isoform epsilon
• Gene ID: 580
• mRNA Refseq: NM_000465
• Protein Refseq: NP_000456
• MIM: 601593
• UniProt ID: Q99728