Recombinant Human BAAT protein, GST-tagged

• Cat.No.: BAAT-042H
• Product Overview: Human BAAT partial ORF ( NP_001692, 258 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.52 kDa
• AA Sequence: NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BAAT bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase) [ Homo sapiens ]
• Official Symbol: BAAT
• Synonyms: BAAT; bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase); bile acid Coenzyme A: amino acid N acyltransferase (glycine N choloyltransferase); bile acid-CoA:amino acid N-acyltransferase; BAT; long-chain fatty-acyl-CoA hydrolase; bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase); BACAT; FLJ20300; MGC104432
• Gene ID: 570
• mRNA Refseq: NM_001127610
• Protein Refseq: NP_001121082
• MIM: 602938
• UniProt ID: Q14032